PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn314261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 486aa    MW: 53740.2 Da    PI: 8.6774
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn314261genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.3e-413064051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r+da++slvyeA++r+ dPvyG++g i++lqqq+++l+ael+++++
  Achn314261 306 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLMEVPESQRPDAANSLVYEANVRLGDPVYGCMGAISALQQQVQSLQAELNAVRA 404
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn314261 405 E 405
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.888305406IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-41306403IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MLMESSDLRE NSIKFEQGKK FSSRRMCRET SVIDSVVEVY YGGASGSVPF HWESQPGTPK  60
VKLLVKPVPP VLTPPPLSFH FYSTRKPIKK PSKPTLVHAI LYKLLGRKTS RPLSRSSSSS  120
TSFSLLSSSW SSFRSVPSSL FPDPNVPRKS QLPSPGSSFC SRIGEEEQYE SPILCFGRTN  180
SWSRASFDFD DDQIWHGAYS IQWSARGEED DESTLAELVG SAMLLWQGQT GHELDLTRGI  240
MSLAVSPIYL DERRKLWYKR EFEVVRERFD EIGKKIKREI DALSQMGRRQ ILGGHPPGMN  300
LNTITPCAAC KLLRRRCAEE CPFSPYFSPH EPHKFAAVHK VFGASNVSKM LMEVPESQRP  360
DAANSLVYEA NVRLGDPVYG CMGAISALQQ QVQSLQAELN AVRAEILRLK YRETANNIIA  420
STHAALATPH AVSVAVLQPP SAPPPPLPPS VVVSSSEGSS NLYNPMPAST MGYNSIPSDG  480
VPYFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-69LOB domain-containing protein 15